PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10019516m
Common NameEUTSA_v10019516mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 335aa    MW: 38086.7 Da    PI: 7.3684
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10019516mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.58.7e-191050242
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                     +ien+s r+ tf kR++gilKK +E+S+LC++ ++vii+s+
  Thhalv10019516m 10 FIENNSSRKATFQKRKKGILKKVKEISTLCGVTACVIIYSP 50
                     8**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.6E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.222149IPR002100Transcription factor, MADS-box
CDDcd002668.96E-32285No hitNo description
SuperFamilySSF554558.5E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-171051IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-92338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MTRKKVKLAF IENNSSRKAT FQKRKKGILK KVKEISTLCG VTACVIIYSP YTSNPDVWPS  60
TSDVRRVVSD FQTLPEMDQQ KKMVDQETFL RQRIAKLSEN LRGLEKDNRE QEMIEVMFQC  120
WDGSLERFHL NILDLNDLGY VIGQYQKDIN RKIEILESSS MEMGESSNTA VTATMAHSFE  180
GIGSLAVASA TTAPAAPAAT IHEVYSSSLS AAAATFFTSI QQQQHHHQHQ QFRHPATPHV  240
GFYEQTRNMN LNQIHSRIQQ QPFLEMMNHP DQMSDAYEHM DNRHNPNLHN PFHHQQHQQQ  300
QQIPSDSSTA LTTVSSSSII HVTSPNPTNN TWFH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391378.10.0hypothetical protein EUTSA_v10019516mg
SwissprotQ9FJK31e-106AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLV4KC390.0V4KC39_EUTSA; Uncharacterized protein
STRINGAT5G48670.11e-104(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.14e-80AGAMOUS-like 80